PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G15310.2
Common NameATMIXTA, ATMYB16, MYB16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 315aa    MW: 35728.1 Da    PI: 7.3215
Description myb domain protein 16
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G15310.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +++ g++R++k+c++rw +yl
      AT5G15310.2 14 KGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.93.5e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++  +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
      AT5G15310.2  67 RGKFNLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-25563IPR009057Homeodomain-like
PROSITE profilePS5129418.705961IPR017930Myb domain
SuperFamilySSF466891.09E-3011108IPR009057Homeodomain-like
SMARTSM007177.2E-161363IPR001005SANT/Myb domain
PfamPF002495.4E-171461IPR001005SANT/Myb domain
CDDcd001671.03E-111661No hitNo description
PROSITE profilePS5129425.2562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.7E-2664117IPR009057Homeodomain-like
SMARTSM007173.9E-1666114IPR001005SANT/Myb domain
PfamPF002492.4E-1567112IPR001005SANT/Myb domain
CDDcd001677.90E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030154Biological Processcell differentiation
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGRSPCCDKL GLKKGPWTPE EDQKLLAYIE EHGHGSWRSL PEKAGLHRCG KSCRLRWTNY  60
LRPDIKRGKF NLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLVKMG  120
IDPVTHKPKN ETPLSSLGLS KNAAILSHTA QWESARLEAE ARLARESKLL HLQHYQTKTS  180
SQPHHHHGFT HKSLLPNWTT KPHEVSFSEM KESIPAKIEF VGSSTGVTLM KEPEHDWINS  240
TMHEFETTQM GEGIEEGFTG LLLGGDSIDR SFSGDKNETA GESSGGDCNY YEDNKNYLDS  300
IFNFVDPSPS DSPMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.53940.0bud
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453580570.0
Genevisible250167_at0.0
Expression AtlasAT5G15310-
AtGenExpressAT5G15310-
ATTED-IIAT5G15310-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Function -- GeneRIF ? help Back to Top
  1. Data indicate that the MIXTA-like MYB transcription factors MYB106 and MYB16, which regulate epidermal cell morphology, also regulate cuticle development coordinately with WIN1/SHN1.
    [PMID: 23709630]
  2. These results suggest that MYB16 functions as a major regulator of cuticle formation in vegetative organs, in addition to its effect in reproductive organs and trichomes.
    [PMID: 24169067]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G15310.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G15310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3706130.0AF370613.1 Arabidopsis thaliana myb-related protein-like (F8M21_200) mRNA, complete cds.
GenBankAK2284740.0AK228474.1 Arabidopsis thaliana mRNA for myb-related protein - like, complete cds, clone: RAFL15-07-O19.
GenBankAY5196240.0AY519624.1 Arabidopsis thaliana MYB transcription factor (At5g15310) mRNA, complete cds.
GenBankBT0289290.0BT028929.1 Arabidopsis thaliana At5g15310 mRNA, complete cds.
GenBankX998090.0X99809.1 A.thaliana mRNA for Mixta protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001078589.10.0myb domain protein 16
TrEMBLF4K9R60.0F4K9R6_ARATH; Myb domain protein 16
STRINGAT5G15310.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Mack AM,Crawford NM
    The Arabidopsis TAG1 transposase has an N-terminal zinc finger DNA binding domain that recognizes distinct subterminal motifs.
    Plant Cell, 2001. 13(10): p. 2319-31
    [PMID:11595804]
  3. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  4. Nikiforova V, et al.
    Transcriptome analysis of sulfur depletion in Arabidopsis thaliana: interlacing of biosynthetic pathways provides response specificity.
    Plant J., 2003. 33(4): p. 633-50
    [PMID:12609038]
  5. Hudson ME,Lisch DR,Quail PH
    The FHY3 and FAR1 genes encode transposase-related proteins involved in regulation of gene expression by the phytochrome A-signaling pathway.
    Plant J., 2003. 34(4): p. 453-71
    [PMID:12753585]
  6. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  7. Tepperman JM, et al.
    Expression profiling of phyB mutant demonstrates substantial contribution of other phytochromes to red-light-regulated gene expression during seedling de-etiolation.
    Plant J., 2004. 38(5): p. 725-39
    [PMID:15144375]
  8. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  9. Culligan KM,Robertson CE,Foreman J,Doerner P,Britt AB
    ATR and ATM play both distinct and additive roles in response to ionizing radiation.
    Plant J., 2006. 48(6): p. 947-61
    [PMID:17227549]
  10. Baumann K, et al.
    Control of cell and petal morphogenesis by R2R3 MYB transcription factors.
    Development, 2007. 134(9): p. 1691-701
    [PMID:17376813]
  11. Jakoby MJ, et al.
    Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.
    Plant Physiol., 2008. 148(3): p. 1583-602
    [PMID:18805951]
  12. Oshima Y, et al.
    MIXTA-like transcription factors and WAX INDUCER1/SHINE1 coordinately regulate cuticle development in Arabidopsis and Torenia fournieri.
    Plant Cell, 2013. 25(5): p. 1609-24
    [PMID:23709630]
  13. Oshima Y,Mitsuda N
    The MIXTA-like transcription factor MYB16 is a major regulator of cuticle formation in vegetative organs.
    Plant Signal Behav, 2013. 8(11): p. e26826
    [PMID:24169067]
  14. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]